Search by BoMiProt ID - Bomi10487


Primary Information

BoMiProt ID Bomi10487
Protein Name Vitamin K-dependent protein Z
Organism Bos taurus
Uniprot IdP00744
Milk FractionWhey
Aminoacid Length 396
Molecular Weight 43113
Fasta Sequence https://www.uniprot.org/uniprot/P00744.fasta
Gene Name PROZ
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Plasma
Protein Function Protein Z is a vitamin K-dependent protein that serves as a cofactor for the inhibition of activated factor X by the serpin protein Z-dependent protease inhibitor (ZPI).
PTMs Disulfide bond formation,N-Linked glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P00744|PROZ_BOVIN Vitamin K-dependent protein Z OS=Bos taurus OX=9913 GN=PROZ PE=1 SV=1 AGSYLLEELFEGHLEKECWEEICVYEEAREVFEDDETTDEFWRTYMGGSPCAS*53QPCLNN*59G SCQDSIRGYACTCAPGYEGPNCAFAESECHPLRLDGCQHFCYPGPESYTCSCARGHKLGQ DRRSCLPHDRCACGTLGPECCQRPQGSQQNLLPFPWQVKLTNSEGKDFCGGVLIQDNFVL TTATCSLLYAN*191ISVKTRSHFRLHVRGVHVHTRFEADTGHNDVALLDLARPVRCPDAGRPV CTADADFADSVLLPQPGVLGGWTLRGREMVPLRLRVTHVEPAECGRALN*289ATVTTRTSCER GAAAGAARWVAGGAVVREHRGAWFLTGLLGAAPPEGPGPLLLIKVPRYALWLRQVTQQPS RASPRGDRGQGRDGEPVPGDRGGRWAPT*388ALPPGPLV
Predicted Disorder Regions (356-396)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains.
Bibliography 1.Sofi F, Cesari F, Tu Y, Pratesi G, Pulli R, Pratesi C, Gensini GF, Abbate R, Fedi S, Broze GJ Jr. Protein Z-dependent protease inhibitor and protein Z in peripheral arterial disease patients. J Thromb Haemost. 2009 May;7(5):731-5. doi: 10.1111/j.1538-7836.2009.03325.x. Epub 2009 Feb 18. Erratum in: J Thromb Haemost. 2009 Aug;7(8):1436. Fedi, S [added]. PMID: 19228280; PMCID: PMC2879329. 2.Højrup P, Jensen MS, Petersen TE. Amino acid sequence of bovine protein Z: a vitamin K-dependent serine protease homolog. FEBS Lett. 1985 May 20;184(2):333-8. doi: 10.1016/0014-5793(85)80633-5. PMID: 3888670.