Search by BoMiProt ID - Bomi10483


Primary Information

BoMiProt ID Bomi10483
Protein Name Vesicular glutamate transporter 1/Solute carrier family 17 member 7
Organism Bos taurus
Uniprot IdA4FV52
Milk FractionWhey
Ref Sequence Id NP_001091515.1
Aminoacid Length 560
Molecular Weight 61651
Fasta Sequence https://www.uniprot.org/uniprot/A4FV52.fasta
Gene Name SLC17A7/VGLUT1
Gene Id 518849
Protein Existence Status reviewed

Secondary Information

Protein Function VGLUT1-mediated glutamate release and membrane GluA1 activation may play a critical role in the rapid-acting antidepressant-like effects of scopolamine in mice.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A4FV52|VGLU1_BOVIN Vesicular glutamate transporter 1 OS=Bos taurus OX=9913 GN=SLC17A7 PE=2 SV=1 MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLP RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVMQKAQFNWDPETVGLIH GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFT SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ IADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY GGVIFYGVFASGEKQPWAEPEEMS*504EEKCGFVGHDQLAGSDESEMEDEAEPPGAPPAPPPS YGATHSTVQPPRPPPPVRDY
Predicted Disorder Regions 497-560
DisProt Annotation
TM Helix Prediction 10TMHs; (65-87),(115-137),(206-228),(237-255),(299-321),(340-362),(380-398),(402-424),(437-459),(468-490)
Additional Comments VGLUT1 knockdown alleviated the rapid antidepressant-like actions of scopolamine and the effects of scopolamine on membrane GluA1-mediated BDNF, VGF and BICC1 changes.VGLUT1 is primarily expressed in the hippocampus and cerebellar cortex and plays a critical role in the glutamate release and efficacy of glutamatergic transmission in the CNS