Search by BoMiProt ID - Bomi10482


Primary Information

BoMiProt ID Bomi10482
Protein Name Vesicle-associated membrane protein-associated protein A
Organism Bos taurus
Uniprot IdQ0VCY1
Milk FractionWhey
Ref Sequence Id NP_001069201.1
Aminoacid Length 249
Molecular Weight 27856
Fasta Sequence https://www.uniprot.org/uniprot/Q0VCY1.fasta
Gene Name VAPA
Gene Id 516024
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells gluteal muscle
Protein Function It is a syntaxin-like protein implicated in endoplasmic reticulum (ER)/Golgi vesicle transport, and phospholipid regulation in mammalian cells and yeast, respectively. 
PTMs N-acetylation at Alanine,Phosphorylation at Serine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VCY1|VAPA_BOVIN Vesicle-associated membrane protein-associated protein A OS=Bos taurus OX=9913 GN=VAPA PE=2 SV=1 MASASGTMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYC VRPNSGIIDPGLTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDE LMDSKLRCVFEMPNENDKLNDMEPSKAVPLNAAKQDGPVPKPHSVS*166LSDT*170ETRKLVEECK RLQGEMMKLSEENRLLRDEGLRLRKVAHSEKPGS*214TS*216AVS*219FRENVTSPLPSLLVVIAAIFI GFFLGKFIL
Predicted Disorder Regions 1-9, 131-172, 204-219
DisProt Annotation
TM Helix Prediction 1TMH; (230-248)
Bibliography 1.Wyles JP, McMaster CR, Ridgway ND. Vesicle-associated membrane protein-associated protein-A (VAP-A) interacts with the oxysterol-binding protein to modify export from the endoplasmic reticulum. J Biol Chem. 2002 Aug 16;277(33):29908-18. doi: 10.1074/jbc.M201191200. Epub 2002 May 21. PMID: 12023275.