Search by BoMiProt ID - Bomi10481


Primary Information

BoMiProt ID Bomi10481
Protein Name Vesicle-associated membrane protein 7/VAMP-7/Synaptobrevin-like protein 1
Organism Bos taurus
Uniprot IdQ17QI5
Milk FractionWhey,MFGM
Ref Sequence Id NP_001069770.1
Aminoacid Length 220
Molecular Weight 24962
Fasta Sequence https://www.uniprot.org/uniprot/Q17QI5.fasta
Gene Name VAMP7/SYBL1
Gene Id 613984
Protein Existence Status reviewed

Secondary Information

Protein Function a vesicular SNARE protein,regulates autophagosome formation to maintain mitochondrial homeostasis and control insulin secretion in pancreatic β-cells.
Biochemical Properties the profilin-like longin domain (LD) and the SNARE motif are required for autophagosome formation
PTMs Acetylation on Ala and phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q17QI5|VAMP7_BOVIN Vesicle-associated membrane protein 7 OS=Bos taurus OX=9913 GN=VAMP7 PE=2 SV=1 MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRI VYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSEN KGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDS*167S*168VTFKTTSRNLAR AMCMKNLKLTIIIIIISVVFIYIIVSPLCGGFTWPNCVKK
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 1TMH; (190-212)
Bibliography Aoyagi K, Itakura M, Fukutomi T, Nishiwaki C, Nakamichi Y, Torii S, Makiyama T, Harada A, Ohara-Imaizumi M. VAMP7 Regulates Autophagosome Formation by Supporting Atg9a Functions in Pancreatic β-Cells From Male Mice. Endocrinology. 2018 Nov 1;159(11):3674-3688. doi: 10.1210/en.2018-00447. PMID: 30215699.