Search by BoMiProt ID - Bomi10476


Primary Information

BoMiProt ID Bomi10476
Protein Name Very-long-chain enoyl-CoA reductase/Synaptic glycoprotein SC2/Trans-2,3-enoyl-CoA reductase
Organism Bos taurus
Uniprot IdQ3ZCD7
Milk FractionWhey
Ref Sequence Id NP_001029920.1
Aminoacid Length 308
Molecular Weight 36072
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZCD7.fasta
Gene Name TECR
Gene Id 614105
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells pons 
Protein Function Tgis protein is involved in both the production of very long-chain fatty acids for sphingolipid synthesis and the degradation of the sphingosine moiety in sphingolipids through the sphingosine 1-phosphate metabolic pathway.It also catalyzes the last of the four reactions of the long-chain fatty acids elongation cycle.
PTMs N6-acetylation at Lysine,Phosphorylation at Serine,N-linked Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZCD7|TECR_BOVIN Very-long-chain enoyl-CoA reductase OS=Bos taurus OX=9913 GN=TECR PE=2 SV=1 MKHYEVEILDAKTREKLCFLDKVEPQATIAEIKNLFTKTHPQWYPARQSLRLDPKGKS*58LK DEDVLQKLPVGTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGRKYDFT SSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLRNIFKN*164CTYYWGFAAWMAYYIN HPLYTPPTYGAQQVKLALAIFVICQLGNFSIHMALRDLRPAGSKTRKIPYPTRNPFTWLF LLVSCPN*247YTYEVGSWIGFAIMTQCLPVALFSLVGFTQMTIWAKGKHRSYLKEFRDYPPLR MPIIPFLL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 5TMHs; (85-107),(167-185),(197-215),(236-250),(254-276)