Search by BoMiProt ID - Bomi10473


Primary Information

BoMiProt ID Bomi10473
Protein Name Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2/3-hydroxyacyl-CoA dehydratase 2/Protein-tyrosine phosphatase-like member B
Organism Bos taurus
Uniprot IdQ2KIP8
Milk FractionWhey
Ref Sequence Id NP_001124229.1
Aminoacid Length 254
Molecular Weight 28422
Fasta Sequence https://www.uniprot.org/uniprot/Q2KIP8.fasta
Gene Name HACD2/PTPLB
Gene Id 613886
Protein Existence Status reviewed

Secondary Information

Protein Function Catalyzes the third of the very long-chain fatty acids (VLCFA) elongation four-step cycle (condensation, reduction, dehydration, and reduction). This endoplasmic reticulum-elongation process is characterized by the addition of two carbons to the lipid chain through each cycle.
PTMs Acetylation, Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KIP8|HACD2_BOVIN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Bos taurus OX=9913 GN=HACD2 PE=2 SV=2 MAAAAAIAASKGNGGGGGRAGAGEASSSRRKKGPGPLTTAYLVIYNVVMTAGWLVIAVGL VRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSIQVMSRVFLIWA VTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGV SGELLTIYAALPFVRQAGLYSISLPNKYN*209FSFDYYAFLILIMISYIPLFPQLYFHMIHQR RKILSHTEEHKKFE
Predicted Disorder Regions 1-33, 250-253
DisProt Annotation
TM Helix Prediction 4TMHs; (39-61), (84-106), (171-193), (212-234)
Bibliography Wang, B., Pelletier, J., Massaad, M. J., Herscovics, A., & Shore, G. C. (2004). The yeast split-ubiquitin membrane protein two-hybrid screen identifies BAP31 as a regulator of the turnover of endoplasmic reticulum-associated protein tyrosine phosphatase-like B. Molecular and cellular biology, 24(7), 2767–2778. https://doi.org/10.1128/MCB.24.7.2767-2778.2004