Search by BoMiProt ID - Bomi10471


Primary Information

BoMiProt ID Bomi10471
Protein Name Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
Organism Bos taurus
Uniprot IdP48818
Milk FractionWhey
Ref Sequence Id NP_776919.1
Aminoacid Length 655
Molecular Weight 70649
Fasta Sequence https://www.uniprot.org/uniprot/P48818.fasta
Gene Name ACADVL
Gene Id 282130
Protein Existence Status reviewed

Secondary Information

Protein Function role in fatty acid oxidation. initial rate-limiting step of β-oxidation of long chain fatty acids.
Significance in milk mitochondrial lipid metabolism
PTMs Acetylation, Phosphoprotein, S-nitrosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P48818|ACADV_BOVIN Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ACADVL PE=2 SV=3 MRAARMAQSTGRQLLRLRGVSSWPGELLGQPRPGPARRPYASGVAQAAVDQSDSQPSEAS TREKRANSVSKSFAVGTFKGQLTTDQVFPYPSVLNEDQTQFLKELVGPVTRFFEEVNDAA KNDMLERVEETTMQGLKELGAFGLQVPNELGGVGLCNTQYARLVEIVGMYDLGVGIVLGA HQSIGFKGILLFGTKAQKEKYLPKLASGETIAAFCLTEPSSGSDAASIRSSAVPSPCGKY YTLNGSKIWISNGGLADIFTVFAKTPVTDTATGAVKEKITAFVVERSFGGVTHGPPEKKM GIKASNTAEVYFDGVRVPAENVLGEVGGGFKVAMHILNNGRFGMAAALAGTMKGIIAKAV DHAANRTQFGEKIHNFGLIQEKLARMAMLQYVTESMAYMVSANMDQGSTDFQIEAAISKI FGSEAAWKVTDECIQIMGGMGFMKEPGVERVLRDLRIFRIFEGTNDILRLFVALQGCMDK GKELSGLGNALKNPFGNAGLLLGEAGKQLRRRAGLGS*517GLSLS*522GIVHQELSRSGELAVQAL EQFATVVEAKLIKHKKDIINEQFLLQRLADSAIDLYAMVVVLSRASRSLSEGHPTAQHEK MLCDSWCIEAAARIRENMTALQSDPQQQELFRNFKSISKALVERGGVVTSNPLGF
Predicted Disorder Regions 1 disordered segment; (1-65)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Miller MJ, Burrage LC, Gibson JB, Strenk ME, Lose EJ, Bick DP, Elsea SH, Sutton VR, Sun Q, Graham BH, Craigen WJ, Zhang VW, Wong LJ. Recurrent ACADVL molecular findings in individuals with a positive newborn screen for very long chain acyl-coA dehydrogenase (VLCAD) deficiency in the United States. Mol Genet Metab. 2015 Nov;116(3):139-45. doi: 10.1016/j.ymgme.2015.08.011. Epub 2015 Sep 2. PMID: 26385305; PMCID: PMC4790081.