Search by BoMiProt ID - Bomi10448


Primary Information

BoMiProt ID Bomi10448
Protein Name Vacuolar fusion protein MON1 homolog A
Organism Bos taurus
Uniprot IdQ17QV2
Milk FractionWhey
Ref Sequence Id NP_001015623.1
Aminoacid Length 555
Molecular Weight 61760
Fasta Sequence https://www.uniprot.org/uniprot/Q17QV2.fasta
Gene Name MON1A
Gene Id 520286
Protein Existence Status reviewed

Secondary Information

Protein Function  membrane trafficking 
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q17QV2|MON1A_BOVIN Vacuolar fusion protein MON1 homolog A OS=Bos taurus OX=9913 GN=MON1A PE=2 SV=1 MAADMQRKRSSEGPDGTLAPSDGQSVERAES*31PTPGLAQGMEPGAGQEGAMFVHARS*56YEDL T*61ESEDGAASGESPKEGAGGPPPLATDMRQIS*91QDFSELSTQLTGVARDLQEEMLPGSSEDW PESPGAARRPATEPPRDGAGEGDEEEAAEAWRRHQKHVFVLSEAGKPVYSRYGSEEALSS TMGVMVALVSFLEADKNAIRSIHADGYKVVFVRRSPLVLVAVARTRQSAQELAQELLYIY YQILSLLTGAQLSHIFQQKQNYDLRRLLSGSERITDNLLQLMARDPSFLMGAARCLPLAA AVRDVVSASLQQARARSLVFSILLARNQLVALVRRKDQFLHPIDLHLLFNLISSSSSFRE GEAWTPVCLPKFNAAGFFHAHISYLEPDTDLCLLLVSTDREDFFAVSDCRRRFQERLRKR GAHLALREALRTPYYSVAQVGVPDLRHFLYKSKSSGLFTSPEIEAPYDSEEEQERLLGLY QYLHSRAHNASRPLKTIYYTGPNENLLAWVTGAFELYMCYSPLGTKASAVSAIHKLMRWI RKEEDRLFILTPLTY
Predicted Disorder Regions 2 disordered segments; (1-145), (465-467)
DisProt Annotation
TM Helix Prediction No TM helices