Search by BoMiProt ID - Bomi10437


Primary Information

BoMiProt ID Bomi10437
Protein Name Uterine milk protein
Organism Bos taurus
Uniprot IdP46201
Milk FractionWhey
Ref Sequence Id NP_777222.1
Aminoacid Length 459
Molecular Weight 52366
Fasta Sequence https://www.uniprot.org/uniprot/P46201.fasta
Gene Name SERPINA14
Gene Id 286871
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells found in endometrium.
Protein Function serine protease inhibitor,secreted by the endometrium,under the control of progesterone.Involved in nutrition of the conceptus, growth control, and suppression of the maternal immune system
Significance in milk Involved in nutrition of the conceptus, growth control, and suppression of the maternal immune system
PTMs Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P46201|UTMP_BOVIN Uterine milk protein OS=Bos taurus OX=9913 PE=2 SV=1 MSHGRMNLALSLVFILCGLFNSIFCEKQQHSQKHMNLVLLKKISALSQKMEAHPKDFAQE LFKALIIEDPRKNIIFSPMAMTTTLATLSLGIKSTMRTHHPEDLKLEPKLLDVHKYLQPL VHVGRELVKQKVLKHQHILFINRKMMVNQMLLQQISKLQGMDIQMIDFTDIEKAKKTISH HVAEKTHTKITNLITDLNPETILCLVNHIFFKGILKRAFQPKLTQKEVFFVNDQTKVQVD MMRKTERMLYSRSEELHATMVKMPCKGN*268VSLTLMLPDAGQFDTDLKKMTAKRAKLQKISD FRLVRLILPKLKISFKINFKHLLPKIDPKHILTATAISQAITSKAPLPNLEALHQAEIEL SEHALTVDTAIHTDNLLKVPVKAKEVPAVVKVPMKAKEVPAVVKVPMNTKEVPVVVKVPM NTKEVPVVVKVNRPFLLFVEDEKTQRDLFVGKVLNPQVE
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 1 TMH; (7-25) transmembrane protein