Search by BoMiProt ID - Bomi10427


Primary Information

BoMiProt ID Bomi10427
Protein Name Uridine 5'-monophosphate synthase/OMPdecase
Organism Bos taurus
Uniprot IdP31754
Milk FractionExosomes
Ref Sequence Id NP_803474.1
Aminoacid Length 480
Molecular Weight 52229
Fasta Sequence https://www.uniprot.org/uniprot/P31754.fasta
Gene Name UMPS
Gene Id 281568
Protein Existence Status Reviewed

Secondary Information

Protein Function Orotate phosphoribosyltransferase (OPRT) is engaged in de novo pyrimidine synthesis. It catalyzes oronitine to uridine monophosphate (UMP), which is used for RNA synthesis. De novo pyrimidine synthesis has long been known to play an important role in providing DNA/RNA precursors for rapid proliferative activity of cancer cells.
PTMs Phosphorylation at Ser/Tyr,N-acetylation at Ala
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P31754|UMPS_BOVIN Uridine 5'-monophosphate synthase OS=Bos taurus OX=9913 GN=UMPS PE=2 SV=1 MAAADALLGSLVTGLYDVQAFKFGNFVLKSGLSSPVY*37IDLRGIISRPSILNQVAEMLFQT AENAEINFDTVCGVPYTALPLATIVCSTHEIPMLIRRKEKKDYGTKRLIEGAVNPGDTCL IIEDVVSSGSSVWETAEVLQKEGLKVTDAVVLVDREQGGRDNLQARGIRLHSVCTLSTVL CILEQQKKINAETVERVKRFIQENAFVAANPNDS*214LPSVKKEPKELSFGARAELPGTHPVA AKLLRLMQKKETNLCLSADVSESRELLQLADALGSRICLLKIHVDILNDFTLDVMKELTT LAKRHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHAVPGSGVVKGLEEVGLP LHRACLLVAEMSSAGTLATGSYTEAAVQMAEEHSEFVIGFISGSRVSMKPEFLHLTPGVQ LEAGGDNLGQQYHSPQEVIGKRGSDIIIVGRGIIASANQLEAAKMYRKAAWEAYLSRLAV
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Hozumi Y, Tanaka T, Nakano T, Matsui H, Nasu T, Koike S, Kakehata S, Ito T, Goto K. Orotate phosphoribosyltransferase localizes to the Golgi complex and its expression levels affect the sensitivity to anti-cancer drug 5-fluorouracil. Biomed Res. 2015;36(6):403-9. doi: 10.2220/biomedres.36.403. PMID: 26700594. 2.