Search by BoMiProt ID - Bomi104


Primary Information

BoMiProt ID Bomi104
Protein Name Alpha-S2-casein
Organism Bos taurus
Uniprot IdP02663
Milk FractionWhey
Ref Sequence Id NP_776953.1
Amino Acid Lenth 222
Molecular Weight 26019
Fasta Sequence https://www.uniprot.org/uniprot/P02663.fasta
Gene Name CSN1S2
Gene Id 282209
Protein Existence Status Reviewed: Experimental evidence at protein level

Secondry Information

Endogenous/Bioactive peptides - Fragment - Sequence - Effect 94–103 - QKALNEINQF - ACE inhibition Ref
163–176 - TKKTKLTEEEKNRL - ACE inhibition Ref
Protein Function Have unique antibacterial properties; angiotensin- I enzyme inhibitor; serve to dampen allergenic responses; formation of health-promoting dairy products; inhibit calmodulin-activation of cyclic nucleotide phosphodiesterase; may be involved in promoting intestinal health and well being ; caprine caseins rich in αS2-CN offer enhanced sites for interactions with the common food additive κ-carrageenan
Biochemical Properties occur primarily as a monomer with an internal disulfide; can form dimers with the chains either parallel or antiparallel to each other; αS2-CN is more sensitive to Ca2+ than αS1-CN with almost complete precipitation occurring in 2 mM Ca2+ for αS2-CN at pH 7; least susceptible to aggregation as initially purified from milk
Significance in milk found to enhance calcium absorption resulted in the production of greater bone mass and correspondingly increased resistance to bone fracture in the rat femurs
PTMs Phosphorylated; 11 phosphorylated serine residues; phosphorylated residues varies from 10 to 13 minor degrees of intermolecular disulfide bonding
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P02663|CASA2_BOVIN Alpha-S2-casein OS=Bos taurus OX=9913 GN=CSN1S2 PE=1 SV=2
MKFFIFTCLLAVALAKNTMEHVS*23S*24S*25EES*28IISQETYKQEKNMAINPS*46KENL CSTFCKEVVRNANEEEYSIGS*71S*72S*73EES*76AEVATEEVKITVDDKHYQKALNEI NQFYQKFPQYLQYLYQGPIVLNPWDQVKRNAVPITPTLNREQLSTSEENS KKTVDMES*158TEVFTKKTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQ HQKAMKPWIQPKTKVIPYVRYL
PDB ID 6FS4, 6FS5,
Bibliography 1. Spuergin, P., Mueller, H., Walter, M., Schiltz, E., & Forster, J. (1996). Allergenic epitopes of bovine alpha S1-casein recognized by human IgE and IgG. Allergy, 51(5), 306–312. https://doi.org/10.1111/j.1398-9995.1996.tb04614.x.
2. Masoodi, T. A., & Shafi, G. (2010). Analysis of casein alpha S1 & S2 proteins from different mammalian species. Bioinformation, 4(9), 430.
3. Farrell, H. M., Malin, E. L., Brown, E. M., & Mora-Gutierrez, A. (2009). Review of the chemistry of αS2-casein and the generation of a homologous molecular model to explain its properties. Journal of Dairy Science, 92(4), 1338–1353. https://doi.org/10.3168/jds.2008-1711.
4. Srinivas S, Prakash V. Bioactive peptides from bovine milk α-casein: Isolation, characterization and multifunctional properties. Int J Pept Res Ther. 2010 Mar;16(1):7–15.