Search by BoMiProt ID - Bomi10265


Primary Information

BoMiProt ID Bomi10265
Protein Name Ubiquitin-conjugating enzyme E2 S/E2 ubiquitin-conjugating enzyme S Ubiquitin carrier protein S/Ubiquitin-protein ligase S
Organism Bos taurus
Uniprot IdQ1RML1
Milk FractionWhey
Ref Sequence Id NP_001069940.1
Aminoacid Length 223
Molecular Weight 23896
Fasta Sequence https://www.uniprot.org/uniprot/Q1RML1.fasta
Gene Name UBE2S
Gene Id 617703
Protein Existence Status reviewed

Secondary Information

Protein Function Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes 'Lys-11'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1RML1|UBE2S_BOVIN Ubiquitin-conjugating enzyme E2 S OS=Bos taurus OX=9913 GN=UBE2S PE=2 SV=2 MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLF RMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLL IHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGGRPEPGRATAS*174GAAAST ADPTAPGGPAGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
Predicted Disorder Regions (1-9), (155-223)
DisProt Annotation
TM Helix Prediction no TM helices
Bibliography Chang, T. L., Kakhniashvili, D. G., & Goodman, S. R. (2005). Spectrin's E2/E3 ubiquitin conjugating/ligating activity is diminished in sickle cells. American journal of hematology, 79(2), 89–96. https://doi.org/10.1002/ajh.20351