Search by BoMiProt ID - Bomi10257


Primary Information

BoMiProt ID Bomi10257
Protein Name Ubiquitin-conjugating enzyme E2 C/(E3-independent) E2 ubiquitin-conjugating enzyme C (EC:2.3.2.24)/E2 ubiquitin-conjugating enzyme C/Ubiquitin carrier protein C/Ubiquitin-protein ligase C
Organism Bos taurus
Uniprot IdQ32PA5
Milk FractionWhey
Ref Sequence Id NP_001032526.1
Aminoacid Length 179
Molecular Weight 19608
Fasta Sequence https://www.uniprot.org/uniprot/Q32PA5.fasta
Gene Name UBE2C/UBCH10
Gene Id 506962
Protein Existence Status reviewed

Secondary Information

Protein Function degradation of mitotic cyclins to regulate cell cycle progression.Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.
PTMs Acetylation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32PA5|UBE2C_BOVIN Ubiquitin-conjugating enzyme E2 C OS=Bos taurus OX=9913 GN=UBE2C PE=2 SV=1 MAS*3QNRDPVAASVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLF KWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKD KWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVSSQDP
Predicted Disorder Regions 1-30, 172-179
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Jin Z, Zhao X, Cui L, Xu X, Zhao Y, Younai F, Messadi D, Hu S. UBE2C promotes the progression of head and neck squamous cell carcinoma. Biochem Biophys Res Commun. 2020 Mar 5;523(2):389-397. doi: 10.1016/j.bbrc.2019.12.064. Epub 2019 Dec 20. PMID: 31870550.