Search by BoMiProt ID - Bomi10224


Primary Information

BoMiProt ID Bomi10224
Protein Name Ubiquitin carboxyl-terminal hydrolase BAP1/BRCA1-associated protein 1
Organism Bos taurus
Uniprot IdA2VDM8
Milk FractionWhey
Ref Sequence Id NP_001096019.1
Aminoacid Length 711
Molecular Weight 78333
Fasta Sequence https://www.uniprot.org/uniprot/A2VDM8.fasta
Gene Name BAP1
Gene Id 100124510
Protein Existence Status reviewed

Secondary Information

Protein Function a potent tumour suppressor gene ,localizes to ER,binds, deubiquitylates, and stabilizes type 3 inositol-1,4,5-trisphosphate receptor (IP3R3), modulating calcium (Ca2+) release from the endoplasmic reticulum into the cytosol and mitochondria, promoting apoptosis.
Biochemical Properties ubiquitin C-terminal hydrolase.Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).
PTMs ubl conjugation,Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A2VDM8|BAP1_BOVIN Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Bos taurus OX=9913 GN=BAP1 PE=2 SV=1 MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTK GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRL FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKYEARLHVLKVNRQTVLEA LQQLIRVTQPELIQTHKSQESQLPEESKPASSKS*274PLALETSRAPVASESTHTDGVEEVAG SCPQAPTHSPPSKPKLVVKPPGSNINGVPPNPTPIVQRLPAFLDNHNYAKS*351PMQEEEDLA AGVGRSRVPVRPPQQYS*377DDEDDYEDEEEDDAQSTSSAIRYKRKGPGKPGPLSSSGDGQLS VLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNEST*475DTASE IGSAFNSPLRSPIRSANPTRPSS*503PVTSHISKVLFGEDDS*519LLRVDCIRYNRAVRDLGPVIS TGLLHLAEDGVLSPLALTESGKGSSPS*567IRPSQGSQGSGS*579PEEKEVVEAVDSREKPGLVRP SESLNGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTF ISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ
Predicted Disorder Regions 254-280, 294-342, 356-414, 427-512, 534-547, 560-589, 684-711
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs The ubiquitin-conjugating enzyme UBE2O induces BAP1 sequestration in the cytoplasm by multi-monoubiquitylation of its nuclear localization signal (NLS).
Additional Comments Cells with reduced levels of BAP1 exhibit chromosomal abnormalities and decreased DNA repair by homologous recombination, indicating that BAP1 dosage is critical. Cells with extensive DNA damage should die and not grow into malignancies.
Bibliography Bononi A, Giorgi C, Patergnani S, Larson D, Verbruggen K, Tanji M, Pellegrini L, Signorato V, Olivetto F, Pastorino S, Nasu M, Napolitano A, Gaudino G, Morris P, Sakamoto G, Ferris LK, Danese A, Raimondi A, Tacchetti C, Kuchay S, Pass HI, Affar EB, Yang H, Pinton P, Carbone M. BAP1 regulates IP3R3-mediated Ca2+ flux to mitochondria suppressing cell transformation. Nature. 2017 Jun 22;546(7659):549-553. doi: 10.1038/nature22798. Epub 2017 Jun 14. PMID: 28614305; PMCID: PMC5581194.