Search by BoMiProt ID - Bomi10219


Primary Information

BoMiProt ID Bomi10219
Protein Name Ubiquitin carboxyl-terminal hydrolase 37/Deubiquitinating enzyme 37/Ubiquitin thioesterase 37/Ubiquitin-specific-processing protease 37
Organism Bos taurus
Uniprot IdF1N5V1
Milk FractionWhey
Ref Sequence Id NP_001258921.1
Aminoacid Length 981
Molecular Weight 110398
Fasta Sequence https://www.uniprot.org/uniprot/F1N5V1.fasta
Gene Name USP37
Gene Id 407168
Protein Existence Status reviewed

Secondary Information

Protein Function remove mono-ubiquitin or ubiquitin chains from substrate proteins.USP37 directly binds, deubiquitinates, and stabilizes SNAI1. which is an epithelial-mesenchymal transition (EMT)-inducing transcription factor, promotes tumor metastasis and resistance to apoptosis and chemotherapy.deubiquitinates Cdt1 and contributes to regulate DNA replication.USP37 is a DUB that associates with and antago- nizes APCCDH1 following E2F-mediated USP37 transcription in G1.
Biochemical Properties Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).
PTMs Ubiquitination.Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|F1N5V1|UBP37_BOVIN Ubiquitin carboxyl-terminal hydrolase 37 OS=Bos taurus OX=9913 GN=USP37 PE=3 SV=1 MSPLKIHGPIRIRSMQTGITKWKEGSFEVVEKENKVSLVVHYNTGGIPRIFQLSHNIKNV VLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLNAAMKPSQGSGSF GAILGSRTSQKETNRQLSYSDNQVSSKRGSLETKDDTPFRKVLGNPSRGS*170IKAAAGNGVT PARTIPSLTSTSTPLRSGLLENRTEKRKRMLS*212SGSELNEDYPKENDSSSNNKAMTDPSRK YLTSSREKQLSLKQSEENRTSGLLPLQSSSFYGSRTAAKDYSPGSTNLDRTNISSQTPSA KRSLGFLPQPAPLSVKKLRCNQDYTGWNKPRVPLSSHQQQQLQGFSNLGNTCYMNAILQS LFSLQSFANDLLKQGIPWKKIPLNALIRRFAHLLVKKDICNSETKKDLLKKVKNAISATA ERFSGYMQNDAHEFLSQCLDQLKEDMEKLNKTWKIEPVPGEENSPDISATRVYTCPVITN LEFEVQHSIICKVCGEIIPKREQFNDLSIDLPRRKKPLPPRSIQDSLDLFFRAEELEYSC EKCGGKCALVRHKFNRLPRILILHLKRYSFNVALSLNNKIGQQVIIPRYLTLSSHCTENT KPPFNLGWSAQMAVSRPLKASQMVNSCITS*630PSTPSKNFTFKSKTSLALSLDS*652DS*654EDELKR SVALSHRLCEMSGSEQQQEDLEKDSKSCRIEPDKSELENSGFDGMSEEELLAAVLEISKR EASPSLSHEDDDKPTSSPDTGFAEDDIQEMPENPDSVETEKPKTITEPDPAS*772FTEITKDC DENKENKTPEGSQGEVDWLQQYDMEREREEQELQQALAQSLQEQEAWEQKEDDDLKRATE LSLQEFNNSFVDSLGSDEDSGNEDVLDMEYTEAEAEELKRNAETGNLPHSYRLISVVSHI GSTSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEASVQSDRDRSGYIFFYMHKEIFDELL ETEKNSQALNLEVGKTTRQVS
Predicted Disorder Regions 115-191, 213-233, 259-282, 666-885
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs USP37 is a substrate of ubiquitination k11 by the APC/CCdh1 and its regulated during the cell cycle as USP37 levels increase at the G1/S boundary, and remain high during S and G2 phases.phosphoryla-tion of Ser-628 contributing to USP37 activation.Phosphorylated at Ser-628 by CDK2 during G1/S phase but not during mitosis.
Bibliography 1.Xiao Z, Chang L, Kim J, Zhang P, Hang Q, Yap S, Guo Y, Zhou Z, Zeng L, Hu X, Siverly A, Sun Y, Ma L. USP37 is a SNAI1 deubiquitinase. Am J Cancer Res. 2019 Dec 1;9(12):2749-2759. PMID: 31911859; PMCID: PMC6943346. 2.Hernández-Pérez S, Cabrera E, Amoedo H, Rodríguez-Acebes S, Koundrioukoff S, Debatisse M, Méndez J, Freire R. USP37 deubiquitinates Cdt1 and contributes to regulate DNA replication. Mol Oncol. 2016 Oct;10(8):1196-206. doi: 10.1016/j.molonc.2016.05.008. Epub 2016 Jun 3. PMID: 27296872; PMCID: PMC5423201. 3.Huang X, Summers MK, Pham V, Lill JR, Liu J, Lee G, Kirkpatrick DS, Jackson PK, Fang G, Dixit VM. Deubiquitinase USP37 is activated by CDK2 to antagonize APC(CDH1) and promote S phase entry. Mol Cell. 2011 May 20;42(4):511-23. doi: 10.1016/j.molcel.2011.03.027. PMID: 21596315.