Search by BoMiProt ID - Bomi10216


Primary Information

BoMiProt ID Bomi10216
Protein Name Ubiquitin carboxyl-terminal hydrolase 20/Deubiquitinating enzyme 20/Ubiquitin thioesterase 20/Ubiquitin-specific-processing protease 20
Organism Bos taurus
Uniprot IdA7Z056
Milk FractionWhey
Ref Sequence Id NP_001098803.1
Aminoacid Length 912
Molecular Weight 101815
Fasta Sequence https://www.uniprot.org/uniprot/A7Z056.fasta
Gene Name USP20
Gene Id 505839
Protein Existence Status reviewed

Secondary Information

Protein Function Deubiquitinating enzyme.can deubiquitinate and stabilize the tumour suppressor protein p53 by reversing its nuclear export and degradation via Mdm2.
Biochemical Properties contains catalytic UCH domain which possess phosphorylated Ser76 site.Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin .
PTMs Phosphorylation and Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7Z056|UBP20_BOVIN Ubiquitin carboxyl-terminal hydrolase 20 OS=Bos taurus OX=9913 GN=USP20 PE=2 SV=1 MGDSRDLCPHLDSIGEVTKEDLLLKSKSTCQSCGVSGPNLWACLQVSCSYVGCGESFADH STLHAQAKKHNLTVNLTTFRVWCYACEKEVFLEPRLAAHPPGPAPKFSEQDS*112PPPSHPLK AVPIAVADEGES*132ES*134EDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV RTDKKPALCKSYQKLVSEVWHRKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM DQLHEELKEPVVATAAALT*259EARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQG RSGGGS*306QAEAELLMADEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALEQ QPPETQPPS*369PRSTSPCRT*378PEPDNEAHMRSSRPCSPVHHHEGHAKLASS*408PHRAS*413PVRMGPAYVLKKAQVPGSRRRKEQSYRSVISDIFDGSVLSLVQCLTCDRVSTTVETFQDLSLPIPGK EDLAKLHSAIYQNVPAKPGACGDSYVAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLEDC LAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKISSH VSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQ YVTEVHETVVQNAEAYVLFYRKSSEEAVRERQQVVSLAAMREPSLLRFYVSREWLNKFNT FAEPGPITNHTFLCSHGGIPPNKYHYIDDLVVILPQNVWEHLYSRFGGGPAVNHLYVCSI CQVEIEALAKRRRVEIDTFIKLNKAFQAEESPSVIYCISMQWFREWEAFVKGKDNEPPGP IDNSRIAQVKGSGHIQLKPGADYGQISEETWVYLNNLYGGGPEIAIRQSVAQLPDPESLH GEQKIEAETRAL
Predicted Disorder Regions 99-135, 259-434
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs phosphorylation of USP10 at residues Thr42 and Ser337 by ATM pathway,promotesthe stability of USP10 and facilitate its translocation from the cytoplasm to the nucleus.Phosphorylated USP10 can inhibit the growth of tumour cells without inducing mutations in p53, which implies that phosphorylation of USP10 has a potential therapeutic effect against tumours.The deubiquitinase activity of USP10 is significantly increased when USP10 is phosphorylated at the Ser76 residue by AMPK under energy stress.
Bibliography Wang Y, Wang F. Post-Translational Modifications of Deubiquitinating Enzymes: Expanding the Ubiquitin Code. Front Pharmacol. 2021 Jun 10;12:685011. doi: 10.3389/fphar.2021.685011. PMID: 34177595; PMCID: PMC8224227.