Search by BoMiProt ID - Bomi10215


Primary Information

BoMiProt ID Bomi10215
Protein Name Ubiquitin carboxyl-terminal hydrolase 16/Deubiquitinating enzyme 16/Ubiquitin thioesterase 16/Ubiquitin-specific-processing protease 16
Organism Bos taurus
Uniprot IdQ08DA3
Milk FractionWhey
Ref Sequence Id NP_001070335.1
Aminoacid Length 826
Molecular Weight 94050
Fasta Sequence https://www.uniprot.org/uniprot/Q08DA3.fasta
Gene Name USP16
Gene Id 519992
Protein Existence Status reviewed

Secondary Information

Protein Function  required for period maintenance of the circadian clock at high temperature in Arabidopsis
Biochemical Properties Ubiquitin carboxyl-terminal hydrolases (UCHs) belong to an enzymatic subclass of DUBs, and are represented by three members in Arabidopsis, UCH1, UCH2 and UCH3. UCH1 and UCH2 infuence auxin-dependent developmental pathways in Arabidopsis through their deubiquitylation activities, whereas biological and enzymatic functions of UCH3 remain unclear.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DA3|UBP16_BOVIN Ubiquitin carboxyl-terminal hydrolase 16 OS=Bos taurus OX=9913 GN=USP16 PE=2 SV=2 MGKKRTKGKTVPIDDSSESLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDK SEEETEENPSVWLCLKCGHQGCGRNSQEQHALKHYMKPRSEPHCLVLSLDNWSVWCYLCD DEVHYCNSNRLGQVVDYVRKQAGNTTPESAEDNGNIELENKKLEKESKNEQEREKKENMA RENPSMNS*188TSQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDL ALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGIVTPRELFSQVCKKAVRFKGYQQQDSQ ELLRYLLDGMRAEEHQRVSKGILKAFDNSTEKVDEELKNKVKEYEKKKSVPSFVDRIFGG ELTSTIMCDECRTVSLVHESFLDLSLPVLDDQSGKKSINDKNLKKTMEDEDKDS*414EEEKDN DSYLKERNDIPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQGKVLHLNDVYAIDHPEDNEC EVEMSLQREADIKSNHISQEEVAPKEYCVNQKDLNGHEKMIESITDNQKS*530TEEAAMKNVS VDNDLEVLASS*551ATECPRNLNGAYLKEGSNGEVDISSGFENLNLNAALQPDEINIEILDDD PTPGTKVYEVVNEDPETAFCTLANREAFNTDECSVQHCLYQFTRNEKLRDANKLLCEVCT RRQYSGPKANMKGERKHIYTNAKKQMLISLAPPVLTLHFKRFQQAGFNLRKVNKHIKFPE ILDLAPFCTLKCKNVAEEHTRVLYSLYGVVEHSGTMRSGHYTAYAKTRTASTHLSNLVLH GDIPQDFEMESTKGQWFHISDTHVQAVPTTKVLSSQAYLLFYERIL
Predicted Disorder Regions 1-16, 58-63, 149-177, 394-404, 432-521,584-588, 674-677
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments UCH3 was originally identifed through a mutant screen as a candidate gene necessary for activation of A. thaliana CONSTANS (CO), a key transcription factor that promotes fowering under long-day (LD) conditions.
Bibliography 1.Hayama, R., Yang, P., Valverde, F. et al. Ubiquitin carboxyl-terminal hydrolases are required for period maintenance of the circadian clock at high temperature in Arabidopsis. Sci Rep 9, 17030 (2019). https://doi.org/10.1038/s41598-019-53229-8