Search by BoMiProt ID - Bomi10213


Primary Information

BoMiProt ID Bomi10213
Protein Name Ubiquitin carboxyl-terminal hydrolase 1/Deubiquitinating enzyme 1//Ubiquitin thioesterase 1/Ubiquitin-specific-processing protease 1
Organism Bos taurus
Uniprot IdQ29RP1
Milk FractionWhey
Ref Sequence Id NP_001039689.1
Aminoacid Length 783
Molecular Weight 88459
Fasta Sequence https://www.uniprot.org/uniprot/Q29RP1.fasta
Gene Name USP1
Gene Id 516328
Protein Existence Status reviewed

Secondary Information

Protein Function USP1 regulates PI3K‐Akt‐FoxO and mTOR signalling in the muscle during prolonged starvation to maintain homeostasis under low energy conditions.It removes K63‐linked and K8 linked polyubiquitin chains from AKT.
Biochemical Properties cysteine proteases,which process ubiquitin chains to reverse protein modification by ubiquitination.Contains a catalytic core composed of conserved N‐terminal Cys box motif and C‐terminal His box motif.
PTMs phosphorylation,Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29RP1|UBP1_BOVIN Ubiquitin carboxyl-terminal hydrolase 1 OS=Bos taurus OX=9913 GN=USP1 PE=2 SV=1 MPGVIPSESNGLSRGS*16PSKKNRLSLKFFQKKETKRALDFTDS*42QENEEKTSEYKGSEIDQV VPAAQSS*67PINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKK EALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVEDLSTKVEEYQKEE MSDNNSMEMDNMRHSEDYKEKLSKGNGKRKSDAEFGNMKKKVKISKEHQSSEENQRQTRS KRKAAGDTLEISHKIIPKHISENESTRPSQRKSKVKINWLKSAAKQPSILSKFCSMGKIA TNQGSKGHCKENEYDLEEDLGKYENDNTTNDCELESPGNNDMPVHVNEVKPINKGAEQIG FELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEENSEIS*473PEPKTEM KTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGLEF DCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKVTD LNSLELDKENFVIDQTCEIGKPEPLNEEEVRGVVENYDNEEVSIRVSGNNQPSKVLNKKN VEAIGLLGGQKSKADYELYNKASNPDKVASTALPENRNSETNNTNGTDESDSNKESSDQT GINISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLS*766PSTSPTSTPYLLFY KKL
Predicted Disorder Regions 9-57, 242-244, 261-282, 305-362, 383-394, 409-415, 620-713
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation is related to its inhibition.autocleavage at an internal diglycine motif (Gly670‐Gly671) that promotes USP1 degradation by the proteasome.
Additional Comments USP1 levels are elevated in several human cancers
Bibliography Goldbraikh D, Neufeld D, Eid-Mutlak Y, Lasry I, Gilda JE, Parnis A, Cohen S. USP1 deubiquitinates Akt to inhibit PI3K-Akt-FoxO signaling in muscle during prolonged starvation. EMBO Rep. 2020 Apr 3;21(4):e48791. doi: 10.15252/embr.201948791. Epub 2020 Mar 5. PMID: 32133736; PMCID: PMC7132338.