Search by BoMiProt ID - Bomi10206


Primary Information

BoMiProt ID Bomi10206
Protein Name Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial/Coenzyme Q biosynthesis protein 4 homolog
Organism Bos taurus
Uniprot IdQ05B52
Milk FractionWhey
Ref Sequence Id NP_001077141.1
Aminoacid Length 151
Molecular Weight 16337
Fasta Sequence https://www.uniprot.org/uniprot/Q05B52.fasta
Gene Name COQ4
Gene Id 511987
Protein Existence Status Reviewed

Secondary Information

Protein Function Component of the coenzyme Q biosynthetic pathway. May play a role in organizing a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis. Required for steady-state levels of other COQ polypeptides
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q05B52|COQ4_BOVIN Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial OS=Bos taurus OX=9913 GN=COQ4 PE=2 SV=1 MATLLRGVLRPLCAFRGGPGPPAGVPFRAVSHGTGLLYPEHIPTSVLQKVLLAAGSAGMA LYDPYRHDMVAVLGETTGRRTLKVLRDQMKRDPEGAQILQERPRISLS*108TLDMGKLRSLPE GSFGCAYLHFLDVNVASGRGMTVCTEDFIQC
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Laugwitz, L., Seibt, A., Herebian, D., Peralta, S., Kienzle, I., Buchert, R., Falb, R., Gauck, D., Müller, A., Grimmel, M., Beck-Woedel, S., Kern, J., Daliri, K., Katibeh, P., Danhauser, K., Leiz, S., Alesi, V., Baertling, F., Vasco, G., Steinfeld, R., … Distelmaier, F. (2021). Human COQ4 deficiency: delineating the clinical, metabolic and neuroimaging phenotypes. Journal of medical genetics, jmedgenet-2021-107729. Advance online publication. https://doi.org/10.1136/jmedgenet-2021-107729