Search by BoMiProt ID - Bomi10179


Primary Information

BoMiProt ID Bomi10179
Protein Name Tyrosine-protein kinase receptor Tie-1
Organism Bos taurus
Uniprot IdQ06805
Milk FractionWhey
Ref Sequence Id NP_776390.1
Aminoacid Length 1136
Molecular Weight 124953
Fasta Sequence https://www.uniprot.org/uniprot/Q06805.fasta
Gene Name TIE1
Gene Id 280941
Protein Existence Status reviewed

Secondary Information

Protein Function  endothelial specific cell surface protein,has proinflammatory property,maintaining vessel integrity.
PTMs phosphorylation,Glycosylation,Disulfide formation,regulated proteolytic cleavage.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q06805|TIE1_BOVIN Tyrosine-protein kinase receptor Tie-1 OS=Bos taurus OX=9913 GN=TIE1 PE=2 SV=1 MVWLEPPLLLPIFFLASHVGAAVDLTLLADLRLTEPQRFFLTCVSGEAGAGRGSDAWGPP LLLEKDDRIVRTPRPWQPPHIARN*84GSSRVTVRGFSQPSDLVGVFSCVGGGGTRVLYVHNS PGAHLLPDKVTHTVNKGDTAVLSARVRKEKQTDVIWKSN*159GSYFYTLDRHEAQDGQFLLQL PNVQPSSSGIYSATYLEASPLGSAFFRLIVRGCEAGRWGQDCTKECPGCLHGGVCHDQDG ECVCPPGFTGTRCEQACREGRFGQSCQEQCPGTSGCRGLTFCLPDPYGCSCGSGWRGSQC QEACAPGRFGADCHLQCQCQNGGTCDRFSGCVCPSGWHGMHCEKSDRIPQILDMVSELEF NLDTMPRINCAAAGNPFPVRGSMELRKPDGTVLLSTKAIVEPDRTTAEFEVPRLALGDSG LWECRVSTSGGQDSRRFRINVKVPPVPLTAPRLLAKQSRQLVVSPLVSFSGDGPIASVRL HYRPQDSTMAWSTIVVDPSEN*501VTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTTDC PEPLLKPWLEGWHVEGPDRLRVSWSLPPVPGPLVGDGFLLRLWDGARGQERREN*594VSSPQA RTALLTGLTPGTYYQLDVRLYHCTLLGPASPAARVLLPPSGPPAPRHLHAQALSDSEIQL MWQRPEAAAGPISKYIVEVQVAGGSGDPLWMDVDRPEETSTIVRGLN*707ASTRYLFRVRASV QGPGDWSNVVEQSTLGNGLQIEGPVQEIHAAEEGLDQQLVLAVVGSVSATCLTILAALLT LACIRKSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKPQPEPLNYPVLEWEDITFE DLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNIIN LLGACENRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFASD AANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVY*1005VKKTMGRLPVRWMAI ESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQAYRMEQPRNCDDEV YELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs When overexpressed in endothelial cells in vitro, Tie-1 is found to be tyrosine-phosphorylated,which probably upregulates VCAM-1, E-selectin, and ICAM-1, partly through a p38-dependent mechanism.regulated proteolytic cleavage which results in 2 fragments one is of 135kD which is fully glycosylated surface expressed receptor and and smaller one 46kD which corresponds to intracellular signaling.
Bibliography 1.Marron MB, Hughes DP, McCarthy MJ, Beaumont ER, Brindle NP. Tie-1 receptor tyrosine kinase endodomain interaction with SHP2: potential signalling mechanisms and roles in angiogenesis. Adv Exp Med Biol. 2000;476:35-46. doi: 10.1007/978-1-4615-4221-6_3. PMID: 10949653. 2.Chan B, Yuan HT, Ananth Karumanchi S, Sukhatme VP. Receptor tyrosine kinase Tie-1 overexpression in endothelial cells upregulates adhesion molecules. Biochem Biophys Res Commun. 2008 Jul 4;371(3):475-9. doi: 10.1016/j.bbrc.2008.04.091. Epub 2008 Apr 28. PMID: 18448073.