Search by BoMiProt ID - Bomi10154


Primary Information

BoMiProt ID Bomi10154
Protein Name Tumor suppressor candidate 3/Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TUSC3/Oligosaccharyl transferase subunit TUSC3/Magnesium uptake/transporter TUSC3
Organism Bos taurus
Uniprot IdQ32L57
Milk FractionWhey,Casein
Ref Sequence Id NP_001074383.1
Aminoacid Length 347
Molecular Weight 39536
Fasta Sequence https://www.uniprot.org/uniprot/Q32L57.fasta
Gene Name TUSC3
Gene Id 615007
Protein Existence Status reviewed

Secondary Information

Protein Function prevents the epithelial-to-mesenchymal transition and inhibits tumor growth by modulating the endoplasmic reticulum stress response in ovarian cancer cells
Biochemical Properties TUSC3 is an Mg2+ -transporter involved in magnesium transport and homeostasis, which is important for learning and memory, embryonic development and testis maturation.
PTMs Methylation and Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32L57|TUSC3_BOVIN Tumor suppressor candidate 3 OS=Bos taurus OX=9913 GN=TUSC3 PE=2 SV=1 MGARGAPSRRRQAGRRPRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWS SRRSVFRMNGDKFRKFIKAPPRN*83YSMIVMFTALQPQRQCSVCRLANEEYQILANSWRYSS AFCNKLFFSKVDYDEGTDIFQQLNINSAPTFMHFPPKGRPKRADTFDLQRIGFGAEQLAK WIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQVQFVAESHIILVLNAAITMGMDLLNE AATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSFLIK
Predicted Disorder Regions (1-17)
DisProt Annotation
TM Helix Prediction 5TMHs; (20-42),(199-217),(230-248),(283-301),(314-332)
Significance of PTMs Epigenetic silencing of TUSC3 has been associated with poor prognosis, and hypermethylation of its promoter provides an independent biomarker of overall and disease-free survival in ovarian cancer patients.
Bibliography 1.Kratochvílová K, Horak P, Ešner M, Souček K, Pils D, Anees M, Tomasich E, Dráfi F, Jurtíková V, Hampl A, Krainer M, Vaňhara P. Tumor suppressor candidate 3 (TUSC3) prevents the epithelial-to-mesenchymal transition and inhibits tumor growth by modulating the endoplasmic reticulum stress response in ovarian cancer cells. Int J Cancer. 2015 Sep 15;137(6):1330-40. doi: 10.1002/ijc.29502. Epub 2015 Mar 21. PMID: 25735931. 2.Yu X, Zhai C, Fan Y, Zhang J, Liang N, Liu F, Cao L, Wang J, Du J. TUSC3: a novel tumour suppressor gene and its functional implications. J Cell Mol Med. 2017 Sep;21(9):1711-1718. doi: 10.1111/jcmm.13128. Epub 2017 Mar 8. PMID: 28272772; PMCID: PMC5571513.