Search by BoMiProt ID - Bomi10153


Primary Information

BoMiProt ID Bomi10153
Protein Name Tumor protein p63-regulated gene 1-like protein/Mossy fiber terminal-associated vertebrate-specific presynaptic protein/Protein FAM79A
Organism Bos taurus
Uniprot IdQ32LJ4
Milk FractionExosomes
Ref Sequence Id NP_001069886.2
Aminoacid Length 275
Molecular Weight 30303
Fasta Sequence https://www.uniprot.org/uniprot/Q32LJ4.fasta
Gene Name TPRG1L
Gene Id 616333
Protein Existence Status Reviewed

Secondary Information

Protein Function It is a presynaptic protein involved in the synaptic transmission tuning.it is involved in the regulation of synaptic release probability by decreasing the calcium sensitivity of release.
PTMs Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32LJ4|TPRGL_BOVIN Tumor protein p63-regulated gene 1-like protein OS=Bos taurus OX=9913 GN=TPRG1L PE=2 SV=2 MLQLRDSVDS*10AGTS*14PTALLAAGEEVGPGSGGGGGGGGRPGVGT*43PLRQTLWPLSVHDPTRR ARVKEYFVFRPGTIEQAVEEIRVVVRPVEDGDIQGVWLLTEVDHWNNEKERLVLITDQAL LICKYDFISLQCQQVVRVALNAVDTISYGEFQFPPKSLNKREGFGIRIQWDKQSRPSFIS RWNPWSTSVPYTTFIEHPMAGVDEKTASLCQLDGFKALLIQAVKKAQKESPLPGQEGGVL VLECPLLIETYVGLMSFINNEAKLGYSMTRGKIGF
Predicted Disorder Regions 1-50,
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation promotes association with synaptic vesicle membranes.