Search by BoMiProt ID - Bomi10140


Primary Information

BoMiProt ID Bomi10140
Protein Name Tudor domain-containing protein 7
Organism Bos taurus
Uniprot IdA6QLE1
Milk FractionWhey
Ref Sequence Id NP_001093779.1
Aminoacid Length 1098
Molecular Weight 123899
Fasta Sequence https://www.uniprot.org/uniprot/A6QLE1.fasta
Gene Name TDRD7
Gene Id 506702
Protein Existence Status reviewed

Secondary Information

Protein Function a class of chromatoid body components,responsible for ordered RNP remodeling of chromatoid bodies.participates in lens development and spermiogenesis as a mediator of autophagy. TDRD7-mediated autophagosome maturation is essential for lens fiber cell homeostasis and acrosome biogenesis.
Biochemical Properties contains three OST-HTH (Oskar-Tdrd7-Helix-Turn-Helix)/LOTUS and three evolutionarily conserved tudor domains.OST-HTH/LOTUS domain regulate RNA metabolic processes. tudor domains bind to methylated arginine residues with in other proteins
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QLE1|TDRD7_BOVIN Tudor domain-containing protein 7 OS=Bos taurus OX=9913 GN=TDRD7 PE=2 SV=1 MLEADLVSKMLRAVLQSHKNGIALPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVV RIETSRSGEVTCYAVACTETARIAQLVARQRSSKRKTGRQVNCQMRVKKTMPFFLEGKPK ATLRQPGFSSDFSVSKKPNSTLLRNKGISLGVKSDAEVLPYTLQTTIGNEVFKDVPVQSH MTMSTNNRFSPKASLPPRFQMHLSRTCTKEMSDNLNQAVEKPNVTPPASYTYKMDEVQNR IKEILNKHSNGIWISKLPHFYKELYKEELNQGILQQFEHWPHICTVEKPCSGGQDLLLYP AKRKQLLRSELNTEKVPPS*319PLPAPKQIPPLKGCPAVMPGDFKEKVAELLVKYSSGLWASA LPKTFEDMYKVKLPEDALKNLDLLSDVCTVDYISGNPQKAILYAKLPSPADKILKDAEQA HGNYDIKSTVEQEYLQIEENIAESTDTFMETVTIPPLIIPTETSPSVLVVELSNTNEVVI RYVGKDYSAAQELMEDEMKEYYSKNSKVTPVQTVQIGQLLAVNAEEDAWLRAQVISMEEG KIKVCYVDYGFSENVEKSKAYRLNPKFCSLSFQATKCKLAGLEVLSDDPDLVKVVESLTC GKIFAVEILEKTDIPLVVLYDTSGEDDININATCLKAICDKSLEVHLQVDAMYTNVRVTN ICSDGTLYCQVPCKGLNKLNDLLHKIEEYFHCKHMTSEYFVSLPFCGKVCLFHCKGKWLR VEITNVHSSRALDVQFLDAGTVTSVKVSELREIPPRFLQEMISVPPQAIKCCLADLPQSI GMWTPDAVLWLRDSVLNCSDCSIKVTKVDETRGIAHIYLFTPKNFPDPHRSINRQITNAD LWKHQKDVFLSAISSGASS*859PNTKSANTPILGNTGETFRKSLTDVLKKSVVNHPSSFFTKE LPPPVHLSKPGEHMDVYVPVACHPGYFVIQPWQEIHKLEVLMEEMILYYSVSEERHVAVE KDQVYAAKVENKWHRVLLKGILTNGLVSVYELDYGKHELVNMRKVQPLADMFRKLPFQAV TAQLAGVKCNQWSEEASMVFRNHVEKKPLVALVQTVIENTNPWDRKVVVYLVDTSLPDTD IWIHDFMSEYLVELSKVN
Predicted Disorder Regions 89-101, 316-324, 861-867
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Loss of function of TDRD7 leads to a syndrome that involves two developmentally and anatomically different organs, namely, the eye and testis.
Bibliography Tu C, Li H, Liu X, Wang Y, Li W, Meng L, Wang W, Li Y, Li D, Du J, Lu G, Lin G, Tan YQ. TDRD7 participates in lens development and spermiogenesis by mediating autophagosome maturation. Autophagy. 2021 Nov;17(11):3848-3864. doi: 10.1080/15548627.2021.1894058. Epub 2021 Mar 3. PMID: 33618632; PMCID: PMC8632297.