Search by BoMiProt ID - Bomi10139


Primary Information

BoMiProt ID Bomi10139
Protein Name Tudor domain-containing protein 5
Organism Bos taurus
Uniprot IdE1BPH3
Milk FractionWhey
Aminoacid Length 975
Molecular Weight 109626
Fasta Sequence https://www.uniprot.org/uniprot/E1BPH3.fasta
Gene Name TDRD5
Protein Existence Status reviewed

Secondary Information

Protein Function novel component of the intermitochondrial cements (IMCs) and the chromatoid bodies (CBs), which are cytoplasmic ribonucleoprotein granules involved in RNA processing for spermatogenesis
Significance in milk Regulates Milk Synthesis and Proliferation of Bovine Mammary Epithelial Cells
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|E1BPH3|TDRD5_BOVIN Tudor domain-containing protein 5 OS=Bos taurus OX=9913 GN=TDRD5 PE=3 SV=1 MSEQERIQECLRKEIRSLLISTKDGLTPQQLEKEYLLMVGNHLPLRILGYRSTMELVLDM PDVVSVCPCGDGTVILKAIPDESTKGIANLVAKQKSNHKVRNSMQKGRASVCSGPSSRRR VPYRGRVPPILPAVVKSELKDLLALSPVLLSDFENAFANRFGRSFQYVQYGFLSMFEVLN AASDVISVEQTRAGSLLTLKKSVSEEKQRGWPAAKGKIFTQPFRMKQQGSYPIGFPVAKA CFSQPTSNMEPPKQILGMERNSRSNVMETSRLNHSEKLNQLALTLQSWVVSHYGFNGSFS SAKKHKAMYTLRKFTENLMVCCLFNEYMLIFKEQLSPKKLGFLNVIELVGALSDILHVEF REGEQDLLVFDADMKPLASVQPDKKTEAKACVSSPPRNSLSTAVIKETTWDCPSKNHKEP EQKIFKKPNLVVKPLQLQVEINKSQLSLAVANHDIPPDAVRDKKLCRLPPLDTSTLVGVF VEYILSPSQFYIRIYSRDSSELLEDMMIEMRRCYSNQLVSDRYAMPECFIQPGHLCCVRI SEDKWWYRVIIHRILGKQEVEVFYPDFGNIGTVQKSSLRFLKCCYTKLPAQAIPCSLAWV RPVEEHWTSRAVLQFQKLCGLKPLVGVVDEYVDGILNIFLCDTSSNEDVYFHHVLRTEGH AIVCRENVPSKGFRDLNPLALYTKSSVTPEDIVLKELGYHSQQHYFNEDREISPQSKESD LYTLDEIPTGMPYLESVTIGDDIWDENWLPLQAKMGKESDAASHLFTSSLGGKKPYPSCK EIPQKDWCFSTPKDIWDDSWQPSGLVNGMKVEVQIPEGLGAQEKHIDTTRIQKQSNVKSA SDSPALPKLEEFYISLIQSQQSAEGSQFEPSNIQTPPKQIQLSSTPTLVNS*891GSVEGSPES LENEDFSSSSAITVFKDTSQGAVDQLSLILSPEHQISQKFYIPRSTATAALGAAARLATS NSLLHWYPSVKKMET
Predicted Disorder Regions 94-118, 383-387, 837-907
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Yabuta Y, Ohta H, Abe T, Kurimoto K, Chuma S, Saitou M. TDRD5 is required for retrotransposon silencing, chromatoid body assembly, and spermiogenesis in mice. J Cell Biol. 2011 Mar 7;192(5):781-95. doi: 10.1083/jcb.201009043. PMID: 21383078; PMCID: PMC3051809.