Search by BoMiProt ID - Bomi10138


Primary Information

BoMiProt ID Bomi10138
Protein Name Tudor domain-containing protein 3
Organism Bos taurus
Uniprot IdQ2HJG4
Milk FractionWhey
Ref Sequence Id NP_001039891.1
Aminoacid Length 722
Molecular Weight 80808
Fasta Sequence https://www.uniprot.org/uniprot/Q2HJG4.fasta
Gene Name TDRD3
Gene Id 537918
Protein Existence Status reviewed

Secondary Information

Protein Function  TDRD3 is a novel regulator of cell proliferation and invasion in breast cancer cells.
Biochemical Properties Tudor domain of the 'survival of motor neuron' protein and the Tudor domain-containing protein 3 (TDRD3) are highly similar and that they both have the ability to interact with arginine-methylated polypeptides. 
PTMs Isopeptide bond formation,Ubl conjugation,Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2HJG4|TDRD3_BOVIN Tudor domain-containing protein 3 OS=Bos taurus OX=9913 GN=TDRD3 PE=2 SV=1 MAEAPGAALSRAGWYLSDEGIEACTSSPDKVNVNDIILIALNLEGPCVLQIQKIRNVAAP KDNEESQAAPRMLRLQMTDGHISCTAVEFSYLSKISLNTPPGTKVKLSGAVDIKNGFLLL NDSNTTVLGGEVEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHIQVDSREL DRRKTLQVTMPVKPPNDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNMHAAGNR NREILQKEKANKSEGKHEGVYRELVDEKALRHITEMGFSKEASRQALMDNGNNLEAALNV LLNSNKQKPVTGPPLRGKGKGRGRIRS*327EDEEELGNARPSAPSTLFDFLESKMGTLSVEEP KSQPQQLHQGQNRVSNTEQNGVKDNNQPRYLPRNDTRQPRNEKPPRFQRDTQNSKAVLEG SGLPRNRGSERPSTSSGSEGWAEERTKCDRSYSRYDRTKDTSYLLSSQHSDTVFKKRDNS MQSRSGKGPSYTEAKENPFPQESVDYNNHKRGKRENQTANSDHFYDRKPRTINNEAFSGV KIEKHFNVNTDYQHPVRMNSFIGVPNGETEMPLKGRRVGPIKPAGPIMASSCDDKIFYSS GPKRRSGPIKPEKVLESSIPMEYAKLWKSGDECLALYWEDNKFYRAEVEALHSSGMTAVV KFIDYGNYEEVLLSNIRPIQSEAWEEEGTYDQTLEFRRGGDGQPRRSTRPTQQFYQPPRA RN
Predicted Disorder Regions 222-226, 309-409, 454-461, 476-479, 704-722
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation suppresses its interaction with KLHL18 and downregulates its KLHL18-mediated degradation. Phosphorylation normally occurs under light conditions than dark conditions.
Additional Comments TDRD3 regulates the expression of a number of key genes associated with promotion of breast cancer tumorigenesis and disease progression. 
Bibliography 1.Morettin A, Paris G, Bouzid Y, Baldwin RM, Falls TJ, Bell JC, Côté J. Tudor Domain Containing Protein 3 Promotes Tumorigenesis and Invasive Capacity of Breast Cancer Cells. Sci Rep. 2017 Jul 11;7(1):5153. doi: 10.1038/s41598-017-04955-4. PMID: 28698590; PMCID: PMC5506013. 2.Goulet I, Boisvenue S, Mokas S, Mazroui R, Côté J. TDRD3, a novel Tudor domain-containing protein, localizes to cytoplasmic stress granules. Hum Mol Genet. 2008 Oct 1;17(19):3055-74. doi: 10.1093/hmg/ddn203. Epub 2008 Jul 15. PMID: 18632687; PMCID: PMC2536506.