Search by BoMiProt ID - Bomi10132


Primary Information

BoMiProt ID Bomi10132
Protein Name Tubulin-specific chaperone E/Tubulin-folding cofactor E
Organism Bos taurus
Uniprot IdQ32KS0
Milk FractionWhey
Ref Sequence Id NP_001033121.1
Aminoacid Length 528
Molecular Weight 59327
Fasta Sequence https://www.uniprot.org/uniprot/Q32KS0.fasta
Gene Name TBCE
Gene Id 505066
Protein Existence Status reviewed

Secondary Information

Protein Function enhances microtubule nucleation around chromatin, thereby facilitating mitotic spindle assembly.
Biochemical Properties  There is free exchange of β-tubulin between TBCA and TBCD, and of α-tubulin between TBCB and TBCE, resulting in the formation of TBCD/β and TBCE/α, respectively. The latter two complexes interact, forming a supercomplex (TBCE/α/TBCD/β). Discharge of the native α/β heterodimer occurs via interaction of the supercomplex with TBCC, which results in the triggering of TBC-bound β-tubulin (E-site) GTP hydrolysis. 
PTMs Acetylation and Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32KS0|TBCE_BOVIN Tubulin-specific chaperone E OS=Bos taurus OX=9913 GN=TBCE PE=2 SV=1 MNSTSTSDVIGRRVEVNGEHATVRFSGLVPPVAGLWLGVEWDNPERGKHDGSHEGTVYFK CRHPTAGSFIRPHKVNFGVDFLTAIKNRYVLEDEPKEEETEQIVIIGNKPVETIGFDSVI KQQSQLSKLQDVSLRNCAVNGAGDKGEIAKACPNIRSIDLSKNLLSSWEEVIDIADQLKH LEVLNLSENKLTSPSSSPSPTGTFPTLKVLVLNRTGVTWAEVLRCASGWPVLEKLYLESN NIIISERPTDVLQTVKLLDLSSNQLIDENQLFLIAYLPRLEQLILSDIGISSIHFPDAGI GCKTSMFPSLQYLVLNDNQIAQWSFMNELDKLQSLHALSCTRNPLTEGSKDAQTTRQFII ARIGQLRTLNKCAIEPEERRGAELDYRKAFGNEWKKAGGHQDPEKNRPNEEFLAAHPRYQ ALCLKYGAPEDGELKTQQPFLLKNQLLTLKIKYPNQHDQKVIEKQLPDSMTVQKVKGLLS RLLKVPVSELLLSYES*496PKMPGKEVELENDLQPLRFYSVENGDCLLVRW
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Métivier M, Gallaud E, Thomas A, Pascal A, Gagné JP, Poirier GG, Chrétien D, Gibeaux R, Richard-Parpaillon L, Benaud C, Giet R. Drosophila Tubulin-Specific Chaperone E Recruits Tubulin around Chromatin to Promote Mitotic Spindle Assembly. Curr Biol. 2021 Feb 22;31(4):684-695.e6. doi: 10.1016/j.cub.2020.11.009. Epub 2020 Nov 30. PMID: 33259793. 2.Tian G, Cowan NJ. Tubulin-specific chaperones: components of a molecular machine that assembles the α/β heterodimer. Methods Cell Biol. 2013;115:155-71. doi: 10.1016/B978-0-12-407757-7.00011-6. PMID: 23973072; PMCID: PMC4961357.