Search by BoMiProt ID - Bomi10127


Primary Information

BoMiProt ID Bomi10127
Protein Name Tubulin-folding cofactor B/Cytoskeleton-associated protein 1/Tubulin-specific chaperone B
Organism Bos taurus
Uniprot IdQ5E951
Milk FractionExosomes
Ref Sequence Id NP_001014939.1
Aminoacid Length 244
Molecular Weight 27518
Fasta Sequence https://www.uniprot.org/uniprot/Q5E951.fasta
Gene Name TBCB
Gene Id 530447
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells scapular muscle
Protein Function Tubulin folding cofactor B (TBCB) is an important member of the TBC family in cells. It is important for the proper folding of β-tubulin and the formation of α/β-tubulin heterodimers, which are critical for the normal growth of mammalian cells 
PTMs N-acetylation at Meth,Phosphorylation at Ser/Tyr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5E951|TBCB_BOVIN Tubulin-folding cofactor B OS=Bos taurus OX=9913 GN=TBCB PE=2 SV=1 MEVTGLSAPTVNVFISSSLNSFRSQKRYSRSLTVAEFKCKLQLVVGSPASCMELELYGPD DKFCCKLDQDDALLGSYPVDDGCRIHVIDHSGARLGEY*98EDISKVEKYEIS*110QEAYEQRQDS IRSFLKRNKLGRFNEEERAQQEAENSQRLIEEEAQASTIPVGSRCEVRTPGQPPRRGTVM YVGLTDFKPGYWIGIRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPSVVTVGDFPEEDYG LDEM
Predicted Disorder Regions 112-175
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Ubiquitinated in the presence of GAN which targets it for degradation by the proteasome.Phosphorylation by PAK1 is required for normal function.
Additional Comments The level of TBCB expression in breast cancer tissues was significantly upregulated, and TBCB overexpression may increase the degree of malignancy in breast cancer cells.
Bibliography 1. Archer JE, Vega LR, Solomon F. Rbl2p, a yeast protein that binds to beta-tubulin and participates in microtubule function in vivo. Cell. 1995;82:425–434. doi: 10.1016/0092-8674(95)90431-X. 2.Gong J, Wang J, Tian Y, Zhang J, Liang W, Li Z, Yu J, Tang B, He S. Expression of tubulin folding cofactor B in mouse hepatic ischemia-reperfusion injury. Biomed Rep. 2017 May;6(5):525-531. doi: 10.3892/br.2017.891. Epub 2017 Apr 11. PMID: 28515911; PMCID: PMC5431315. 3.Hamel E, Sackett DL, Vourloumis D, Nicolaou KC. The coral-derived natural products eleutherobin and sarcodictyins A and B: Effects on the assembly of purified tubulin with and without microtubule-associated proteins and binding at the polymer taxoid site. Biochemistry. 1999;38:5490–5498. doi: 10.1021/bi983023n.