Search by BoMiProt ID - Bomi10100


Primary Information

BoMiProt ID Bomi10100
Protein Name Troponin T, fast skeletal muscle
Organism Bos taurus
Uniprot IdQ8MKI3
Milk FractionWhey
Aminoacid Length 271
Molecular Weight 32126
Fasta Sequence https://www.uniprot.org/uniprot/Q8MKI3.fasta
Gene Name Tnnt3
Protein Existence Status reviewed

Secondary Information

Protein Function Muscle contraction.Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
Biochemical Properties Binds to tropomyosin and troponin c during muscle contraction.
PTMs Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q8MKI3|TNNT3_BOVIN Troponin T, fast skeletal muscle OS=Bos taurus OX=9913 GN=Tnnt3 PE=2 SV=1 MS*2DEEVEHVEEEYEEEEEAQEEAPPPPAEVPEVHEEVHEVHEPEEVQEEEKPRPRLTAPK IPEGEKVDFDDIQKKRQNKDLMELQALIDS*90HFEARKKEEEELVALKERIEKRRAERAEQQ RIRAEKERERQNRLAEEKARREEEDAKRRAEDDLKKKKALS*161SMGANYS*168S*169YLAKADQKRGK KQTAREMKKKVLAERRKPLNIDHLS*205EDKLRDKAKELWDTLY*221QLETDKFEYGEKLKRQKYD ITNLRSRIDQAQKHSKKAGTAPKGKVGGRWK
Predicted Disorder Regions 1-75, 123-138, 147-149, 164-205, 212-219, 241-271
DisProt Annotation
TM Helix Prediction No TM helices