Search by BoMiProt ID - Bomi101


Primary Information

BoMiProt ID Bomi101
Protein Name Kininogen-1
Organism Bos taurus
Uniprot IdP01044
Milk FractionWhey
Ref Sequence Id NP_786968.2
Amino Acid Lenth 436
Molecular Weight 48428
Fasta Sequence https://www.uniprot.org/uniprot/P01044-2.fasta
Gene Name KNG1
Gene Id 280833
Protein Existence Status Reviewed: Experimental evidence at protein level

Secondry Information

Presence in other biological fluids/tissue/cells tears, CSF, saliva
Protein Function accelerate the activation of factor XII, prekallikrein, and factor XI as cofactor; Fragment 1.2 has also been shown to be a potent inhibitor of the contact activation of factor XII;
Biochemical Properties rich in basic amino acid residue, containing 22 histidines, 13 lysines, and 3 arginines in a total of 110 residues; basic proteins such as protamine, lysozyme, and synthetic polylysine inhibit the activation for factor XII by a negatively charged surface
Significance in milk maintaining the bone strength and content of hydroxyproline
PTMs Bovine fragment 1.2 of HMW kininogen has four oligosaccharide chains that attached to serine and threonine residues. The residues with oligosaccharide chains are S10, T10, T12, S18 from the amino-terminal of the fragment 1.2;
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P01044|KNG1_BOVIN Kininogen-1 OS=Bos taurus OX=9913 GN=KNG1 PE=1 SV=1
MKLITILFLCSRLLPSLTQESSQEIDCNDQDVFKAVDAALTKYNSENKSGNQFVLYRITEVARMDNPDTF YSLKYQIKEGDCPFQSN*87KTWQDCDYKDSAQAATGECTATVAKRGNMKFSVAIQTCLITPA EGPVVTAQYECLGCVHPISTKSPDLEPVLRYAIQYFNN*167N*168TSHSHLFDLKE VKRAQRQVVSGWNYEVN*197YSIAQTN*204CSKEEFSFLTPDCKSLSSGDTGECTDKAHVDVKLRISSFSQKCDLY PVKDFVQPPTRLCAGCPKPIPVDSPDLEEPLSHSIAKLNAEHDGAFYFKIDTVKKATVQVVAGLKYSIVFIARETTCSKGSNEELTKSCEINIHGQILHCDANVYVVPWEEKVYPTVNCQPLGQTSLMKRPPGFSPFRSVQVMKTEGS*398T*399T*400VSLPHS*406AMSP VQDEERDSGKEQGPTHGHGWDHGKQIKLHGLGLGHKHKHDQGHGHHGSHGLGHGHQKQHGLGHGHKHGHG HGKHKNKGKNNGKHYDWRTPYLASSYEDST TS*512SAQTQEKT*520EETT*524LSSLAQPGVAIT*536FPDFQDSDLIAT*548VM PNT*553LPPHTESDDDWIPDIQT*570EPNSLAFKLIS*581DFPETTSPKCPSRPWKPVNGVNPTVEMKESHDFDLVDALL
Bibliography 1. Wilson, W. E., Lazarus, L. H., & Tomer, K. B. (1989). Bradykinin and kininogens in bovine milk. The Journal of Biological Chemistry, 264(30), 17777–17783. Retrieved from http://www.ncbi.nlm.nih.gov/pubmed/2808351.
2. Yamamura, J. I., Takada, Y., Goto, M., Kumegawa, M., & Aoe, S. (2000). Bovine milk kininogen fragment 1·2 promotes the proliferation of osteoblastic MC3T3-E1 cells. Biochemical and Biophysical Research Communications, 269(2), 628–632. https://doi.org/10.1006/bbrc.2000.2326.