Primary Information |
---|
BoMiProt ID | Bomi10083 |
---|
Protein Name | tRNA methyltransferase 10 homolog C/Mitochondrial ribonuclease P protein 1/Mitochondrial RNase P protein 1/RNA (guanine-9-)-methyltransferase domain-containing protein 1/mRNA methyladenosine-N(1)-methyltransferase/tRNA (adenine(9)-N(1))-methyltransferase/tRNA (guanine(9)-N(1))-methyltransferase |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q2KI45 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001039788.1 |
---|
Aminoacid Length | 426 |
---|
Molecular Weight | 49785 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q2KI45.fasta |
---|
Gene Name | TRMT10C/MRPP1/RG9MTD1 |
---|
Gene Id | 532418 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | a subunit of the mitochondrial RNase P complex. Subunits TRMT10C and SDR5C1 form a subcomplex that binds conserved mitochondrial tRNA elements, including the anticodon loop, and positions the tRNA for methylation during RNA processing in mitochondria. |
---|
Biochemical Properties | consists of an N-terminal domain (NTD) and a dual-specificity C-terminal methyltransferase domain, which are both required for establishing a conserved m1G/A methylation at position 9 of mitochondrial tRNAs.methyltransferase domain recognizes the substrate and binds to it.N-terminal of the adapter helix, residues 175–182 of TRMT10C form an ‘adapter loop’, which is stabilized by hydrophobic interactions with SDR5C1. |
---|
PTMs | phosphorylation on Ser-86 |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2KI45|TM10C_BOVIN tRNA methyltransferase 10 homolog C OS=Bos taurus OX=9913 GN=TRMT10C PE=2 SV=2
MPVLLKMSVSITFLRPFARVLVPFTLHRKRRVLYSTIMQRYMSSKIPAASYPNKESTPPS
EELELDRWKITMKSSVQEEDVSTATS*86SEDEDPLAATRELVEMWRLLGKEVPEHFSEEELK
TLMECVSKSSKRKYLKYLYIKEKMKKARQIKKEMKKAEKEEPKKDQLPETIKEDKQQNFL
FLRLWDRNMDIAMGWKGAQAMQFGQPLVFDMAYDDHMKPKELQNAVSQLLESEGCNRRNV
DPFHIYFCNLKTGGAYYKELVKRYGEKWNKLLLTATEKSHVDLFPKDSIIYLTADSPNVM
TTFKHDKIYIVGSFVDKNMQPGTSLAKAKRLKLATECLPLDKYLQWDTGTKNLTLDQMMR
ILLCLKNTGSWEEALKFVPSRKHAGYLEISQHSQEFLNRMKKSKTFNSFPRGSINRHRKS
SLKENI
|
---|
Predicted Disorder Regions | 48-94, 142-171, 403-426 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | mutation of the conserved active site residues D314 or Q226, to asparagine or alanine, respectively, leads to impaired methyltransferase activity |
---|
Bibliography | Bhatta A, Dienemann C, Cramer P, Hillen HS. Structural basis of RNA processing by human mitochondrial RNase P. Nat Struct Mol Biol. 2021 Sep;28(9):713-723. doi: 10.1038/s41594-021-00637-y. Epub 2021 Sep 6. PMID: 34489609; PMCID: PMC8437803. |