Search by BoMiProt ID - Bomi10081


Primary Information

BoMiProt ID Bomi10081
Protein Name Tripartite motif-containing protein 2/E3 ubiquitin-protein ligase TRIM2/RING-type E3 ubiquitin transferase TRIM2
Organism Bos taurus
Uniprot IdA4IF63
Milk FractionWhey
Ref Sequence Id NP_001077204.1
Aminoacid Length 744
Molecular Weight 81476
Fasta Sequence https://www.ncbi.nlm.nih.gov/gene/538617
Gene Name TRIM2
Gene Id 538617
Protein Existence Status reviewed

Secondary Information

Protein Function It plays a neuroprotective role and functions as an E3-ubiquitin ligase in proteasome-mediated degradation of target proteins. TRIM2 also performs an important functions in regulating the development and metastasis of osteosarcoma.
Biochemical Properties The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic filaments
PTMs Phosphorylationa and Ubl Conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A4IF63|TRIM2_BOVIN Tripartite motif-containing protein 2 OS=Bos taurus OX=9913 GN=TRIM2 PE=2 SV=1 MASEATNIPS*10PVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSC PVCRQTSILPEKGVAALQNNFFITNLMDVLQRSPGSSAEESSILETVTAVAAGKPLSCPN HDGNVMDFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAANRRLPEID SALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQ LDTLLEGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLD FIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTIIGQPMSVTITTKDKDGELCKT GNAYLTAELST*371PDGS*375VADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLK VIRS*424ADVS*428PTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKG RNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA VHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVF IFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQEGEFMLKFG SNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLA LTSDGHVVVADSGNHCFKVYRYLQ
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs TRIM2 is phosphorylated by the p42/p44 mitogen-activated protein kinase (MAPK) pathway, it is usually bound to Bim.
Additional Comments Mutations in this gene can cause early-onset axonal neuropathy. Alternative splicing results in multiple transcript variants.
Bibliography 1.Pehlivan D, Coban Akdemir Z, Karaca E, Bayram Y, Jhangiani S, Yildiz EP, Muzny D, Uluc K, Gibbs RA; Baylor-Hopkins Center for Mendelian Genomics, Elcioglu N, Lupski JR, Harel T. Exome sequencing reveals homozygous TRIM2 mutation in a patient with early onset CMT and bilateral vocal cord paralysis. Hum Genet. 2015 Jun;134(6):671-3. doi: 10.1007/s00439-015-1548-3. Epub 2015 Apr 17. PMID: 25893792; PMCID: PMC4426057. 2.Qin Y, Ye J, Zhao F, Hu S, Wang S. TRIM2 regulates the development and metastasis of tumorous cells of osteosarcoma. Int J Oncol. 2018 Oct;53(4):1643-1656. doi: 10.3892/ijo.2018.4494. Epub 2018 Jul 20. PMID: 30066883. 3. Yin H, Zhu Q, Liu M, et al. GPER promotes tamoxifen-resistance in ER þ breast cancer cells by reduced Bim proteins through MAPK/ Erk-TRIM2 signaling axis. Int J Oncol. 2017;51:1191–1198.