Search by BoMiProt ID - Bomi10028


Primary Information

BoMiProt ID Bomi10028
Protein Name Transmembrane protein FAM155A
Organism Bos taurus
Uniprot IdA4IFM1
Milk FractionWhey
Ref Sequence Id NP_001077245.1
Aminoacid Length 457
Molecular Weight 50897
Fasta Sequence https://www.uniprot.org/uniprot/A4IFM1.fasta
Gene Name FAM155A
Gene Id 616912
Protein Existence Status Reviewed

Secondary Information

Protein Function calcium ion import across plasma membrane.Forms a complex with the NALCN channel which furthur mediates sodium leak currents, which positively adjust resting membrane potential towards depolarization.
Biochemical Properties The cysteine-rich domains of FAM155A are highly conserved and, thus, designated as the Mid1 domain.
PTMs Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A4IFM1|NALF1_BOVIN NALCN channel auxiliary factor 1 OS=Bos taurus OX=9913 GN=NALF1 PE=2 SV=1 MTRGAWMCRQYDDGLKIWLAAPRENEKPFIDSERAQKWRLSLASLLFFTVLLSDHLWFCA EAKLTRARDKEQQQQQQQQQQRQQRQRQEQRQRQRQHEPSWPALLASMGEPSPAAQAHRL LSASPSPTLPPSLGGGGGGKGGRGTDSRGKPPLPGNSARPAWRLETCYPQGASSGQCFTV DSADAVCARNWSRGAAARGEQGQQTRGPPQPTPLWN*216LSDFYLSFCNSYTLWELFSGLSSP NTLNCSLDVVLKEGGEMTTCRQCVEAYQDYDHHAQEKYEEFESVLHKYLQSEEYSVKSCP EDCKIVYKAWLCSQYFEVAQLNCRKTIPCKQYCLEVQTRCPFILPDNDEVIYGGLSSFIC TGLYETFLTNDEPECCDVRREAKPKSPSKGAGDRGGACPRTSLSASSAPRLGPSRLRLCV LVLMLLHTVLTASVAHNATALGVGGVHTLDERSASEE
Predicted Disorder Regions 24-34, 67-158, 195-211, 381-400, 449-457
DisProt Annotation
TM Helix Prediction 1TMH; (40-58)
Bibliography Kang, Y., Wu, J. X., & Chen, L. (2020). Structure of voltage-modulated sodium-selective NALCN-FAM155A channel complex. Nature communications, 11(1), 6199. https://doi.org/10.1038/s41467-020-20002-9