Search by BoMiProt ID - Bomi10004


Primary Information

BoMiProt ID Bomi10004
Protein Name Transmembrane protein 184B
Organism Bos taurus
Uniprot IdA2VDL9
Milk FractionWhey
Aminoacid Length 407
Molecular Weight 45490
Fasta Sequence https://www.uniprot.org/uniprot/A2VDL9.fasta
Gene Name TMEM184B
Gene Id 514220
Protein Existence Status Reviewed

Secondary Information

Protein Function is critical for the maintenance of synaptic architecture.NMJ maintainenance
PTMs phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A2VDL9|T184B_BOVIN Transmembrane protein 184B OS=Bos taurus OX=9913 GN=TMEM184B PE=2 SV=1 MTVRGAALAPDPASPTTAAASPSISVIPEGSPTAMEQPVFLMTTAAQAISGFFVWTALLI TCHQIYMHLRCYSCPNEQRYIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEA LVIYNFLSLCYEYLGGESSIMSEIRGKPIESSCMYGTCCLWGKTYSIGFLRFCKQATLQF CVVKPLMAVSTVVLQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELL SPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKIHSARVSVGEGTVAAGYQDFIIC VEMFFAALALRHAFTYKVYADKRVDAQGRCAPMKSISSSLKETMNPHDIVQDAIHNFSPA YQQYTQQSTLEPGPTWRGGAHGLSRSHS*388LSGARDNEKTLLLS*402S*403DDEF
Predicted Disorder Regions 10-24, 326-332, 364-407
DisProt Annotation
TM Helix Prediction 6TMHs; (38-60), (80-102), (117-135), (180-198), (210-232), (239-261)
Bibliography Bhattacharya MR, Geisler S, Pittman SK, Doan RA, Weihl CC, Milbrandt J, DiAntonio A. TMEM184b Promotes Axon Degeneration and Neuromuscular Junction Maintenance. J Neurosci. 2016 Apr 27;36(17):4681-9. doi: 10.1523/JNEUROSCI.2893-15.2016. PMID: 27122027; PMCID: PMC4846669.