Search by BoMiProt ID - Bomi10000


Primary Information

BoMiProt ID Bomi10000
Protein Name Transmembrane protein 168
Organism Bos taurus
Uniprot IdA0JNG0
Milk FractionWhey
Ref Sequence Id NP_001071499.1
Aminoacid Length 697
Molecular Weight 79785
Fasta Sequence https://www.uniprot.org/uniprot/A0JNG0.fasta
Gene Name TMEM168
Gene Id 541075
Protein Existence Status reviewed

Secondary Information

Protein Function Probably involved in cell cycle regulation.One report says that due to the knockdown of TMEM168 ,there is induced cell cycle arrest (G0/G1 phase) and promoted apoptosis, and the mechanisms involved in blocking Wnt/β-catenin pathway.
Biochemical Properties comprises 697 amino acid residues, including some putative transmembrane domains
PTMs Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A0JNG0|TM168_BOVIN Transmembrane protein 168 OS=Bos taurus OX=9913 GN=TMEM168 PE=2 SV=1 MCKSLRYCFSHCLYLAMTRLEEVNREVNMHSSVRYLGYLARINLLVAICLGLYVRWEKTA NSLILVIFILGLFVLGIASILYYYFSMETASLSLSNLWFGFLLGFLCFLDN*111SSFKNDVKE ESTKYLLLTSIVLRILCSLVERMSGYVRHRPTLLTTVEFLELVGFAIASTTMLVEKSLSV ILLVVALAMLIIDLRMKSFLALPNLVIFAVLLFFSSLETPKNPVAFACFFICLITDPFLD IYFSGLSVTERWKPFLYRGRICRRLSVVFTGMIELTFFILSAFKLRDTHLWYFVIPGFSI FGIFWMICHIIFLLTLWGFHTKLNDCHKVCFTHRVDN*337NSLDRIMASKGMRHFCLISEQLV FFSLLATAILGAVSWQPTNGIFLSMFLIVLPLESMAHGLFHELGSCLGGTSVGYAIVIPT NFCSPDGQPTLLPPEHVQELNLRSTGMLNAIQRFFAYHMIETYGCDYSTSGLSFDTLHSK LKAFLELRTVDGPRHDTYVLYYSGHTHGTGEWALAGGDILRLDTLLEWWREKN*533GSFCSRL IIILDSENSTPWVKEVRKINDQYIAVQGAEMTKTIDIEEADPPQLGDFTKDWVEYNCN*598TT NNICWTEKGRTVKAIYGVSKRWSDYTLHLPTGSDVAKHWMLYFPRITYPLVHLANWLCGL NLFWICKTCFRCLKRLKMSWFLPAVLDTGQGFKLVKS
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 10TMHs; (36-54), (63-85), (92-114), (170-192), (199-217) (223-245), (265-283),(298-320), (359-377), (647-665)
Bibliography Xu J, Su Z, Ding Q, Shen L, Nie X, Pan X, Yan A, Yan R, Zhou Y, Li L, Lu B. Inhibition of Proliferation by Knockdown of Transmembrane (TMEM) 168 in Glioblastoma Cells via Suppression of Wnt/β-Catenin Pathway. Oncol Res. 2019 Jul 12;27(7):819-826. doi: 10.3727/096504018X15478559215014. Epub 2019 Mar 25. PMID: 30940290; PMCID: PMC7848296.